PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT25555

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

MYB_related

Protein Properties

Length: 106aa MW: 11967.9 Da PI: 9.3753

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT25555	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.8	1.3e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+ lv +v+++G+g+W++++ + g+ R+ k+c++rw +yl EMT25555 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-25	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	25.561	9	65	IPR017930	Myb domain
SMART	SM00717	2.9E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-17	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	6.15E-23	15	90	IPR009057	Homeodomain-like
CDD	cd00167	1.80E-12	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.8E-7	65	91	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MGRPPCCDKE GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGLMRCS KSCRLRWTNY 60 LRPGIKRGNF TDQEEKLIVH LQALLGNSMS TTACHIFPPL IGQYAK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-14	12	93	25	105	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269\|PubMed:25305760, ECO:0000269\|PubMed:27577115}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269\|PubMed:25305760}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT009312	1e-145	BT009312.1 Triticum aestivum clone wlm1.pk0027.a5:fis, full insert mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020168716.1	4e-61	transcription factor MYB30-like
Swissprot	Q9SN78	1e-56	MYB94_ARATH; Transcription factor MYB94
TrEMBL	M8BKN8	3e-74	M8BKN8_AEGTA; Myb-related protein 306
STRING	EMT25555	5e-75	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP229	38	296

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G47600.1	5e-59	myb domain protein 94

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495] Lee SB,Kim HU,Suh MC MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis. Plant Cell Physiol., 2016. 57(11): p. 2300-2311 [PMID:27577115]