![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT27197 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 171aa MW: 19068 Da PI: 10.2831 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 171.5 | 2.5e-53 | 19 | 148 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...kge 98
lppGfrFhPtdee+v++yL++k+ ++ +++ vi++vd++k+ePwdLp k+k +ekewyfF+++d+ky+tg+r+nrat++gyWkatgkdke+++ +
EMT27197 19 LPPGFRFHPTDEEVVTHYLTPKAVNNAFSC-LVIADVDLNKTEPWDLPGKAKMGEKEWYFFVHKDRKYPTGTRTNRATEKGYWKATGKDKEIFRGkgrDAV 118
79**************************99.78***************99999****************************************98444444 PP
NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128
lvg+kktLvfy+grap+g kt vmheyrl
EMT27197 119 LVGMKKTLVFYTGRAPRGDKTPYVMHEYRL 148
5***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.27E-57 | 16 | 153 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 51.357 | 19 | 171 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.3E-28 | 20 | 148 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 171 aa Download sequence Send to blast |
MSDVTAAVGL GGGGPRLSLP PGFRFHPTDE EVVTHYLTPK AVNNAFSCLV IADVDLNKTE 60 PWDLPGKAKM GEKEWYFFVH KDRKYPTGTR TNRATEKGYW KATGKDKEIF RGKGRDAVLV 120 GMKKTLVFYT GRAPRGDKTP YVMHEYRLAG QLAPRIPRSA KVMLAPLDGR D |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 6e-50 | 16 | 148 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 6e-50 | 16 | 148 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 6e-50 | 16 | 148 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 6e-50 | 16 | 148 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 6e-50 | 16 | 148 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 6e-50 | 16 | 148 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 6e-50 | 16 | 148 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 6e-50 | 16 | 148 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 6e-50 | 16 | 148 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 6e-50 | 16 | 148 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 6e-50 | 16 | 148 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 6e-50 | 16 | 148 | 17 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 6e-50 | 16 | 148 | 14 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 6e-50 | 16 | 148 | 14 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK364498 | 0.0 | AK364498.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2025P03. | |||
| GenBank | AK364649 | 0.0 | AK364649.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2027E04. | |||
| GenBank | AK367098 | 0.0 | AK367098.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2051F14. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020161331.1 | 1e-105 | NAC domain-containing protein 92-like | ||||
| Swissprot | Q9LJW3 | 5e-70 | NAC59_ARATH; NAC domain-containing protein 59 | ||||
| TrEMBL | M8CIT6 | 1e-123 | M8CIT6_AEGTA; Protein CUP-SHAPED COTYLEDON 2 | ||||
| STRING | EMT27197 | 1e-123 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1862 | 38 | 104 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G29035.1 | 3e-68 | NAC domain containing protein 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




