![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT29162 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 62aa MW: 7064.25 Da PI: 11.158 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 97.9 | 4e-31 | 2 | 52 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++g+lye++s
EMT29162 2 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGRLYEFAS 52
79***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd00265 | 6.35E-35 | 1 | 52 | No hit | No description |
| SuperFamily | SSF55455 | 1.44E-26 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 5.3E-31 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.651 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.9E-28 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-19 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-19 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MKRIENATSR QVTFSKRRNG LLKKAFELSV LCDAEVALVV FSPRGRLYEF ASATRSFFHV 60 LA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n6j_A | 8e-16 | 1 | 53 | 7 | 59 | Myocyte-specific enhancer factor 2B |
| 1n6j_B | 8e-16 | 1 | 53 | 7 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_P | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 7e-16 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM502862 | 5e-84 | AM502862.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM1B (WM1B gene). | |||
| GenBank | DQ512363 | 5e-84 | DQ512363.1 Triticum aestivum MADS-box transcription factor TaAGL7 (AGL7) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020161858.1 | 1e-30 | MADS-box transcription factor 56-like isoform X1 | ||||
| Refseq | XP_020161859.1 | 1e-30 | MADS-box transcription factor 56-like isoform X2 | ||||
| Refseq | XP_020179424.1 | 7e-31 | agamous-like MADS-box protein AGL14 | ||||
| Swissprot | Q9XJ60 | 6e-30 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
| TrEMBL | M8CNT0 | 1e-36 | M8CNT0_AEGTA; MADS-box transcription factor 50 | ||||
| STRING | EMT29162 | 2e-37 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11880.1 | 3e-29 | AGAMOUS-like 14 | ||||




