PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT30903

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

MYB_related

Protein Properties

Length: 101aa MW: 11320.7 Da PI: 8.4762

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT30903	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48	2.9e-15	39	84	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+WT eEd ll v+++G g+W+ + +++ gR++kqc++rw + EMT30903 39 KGSWTVEEDTLLRVKVQEFGLGRWAEVTLYLP-GRSGKQCRERWTNQ 84 799***************************.*********985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	19.961	34	89	IPR017930	Myb domain
SMART	SM00717	1.4E-13	38	87	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.8E-19	39	88	IPR009057	Homeodomain-like
SuperFamily	SSF46689	6.49E-17	39	93	IPR009057	Homeodomain-like
Pfam	PF00249	4.7E-15	39	84	IPR001005	SANT/Myb domain
CDD	cd00167	2.66E-14	41	83	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MDPTSFPGYG SSDAPTAITA TARALPRARY SSQGLTRFKG SWTVEEDTLL RVKVQEFGLG 60 RWAEVTLYLP GRSGKQCRER WTNQLDPNIE VISQDLNFLT P

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269\|PubMed:16214903, ECO:0000269\|PubMed:17693534, ECO:0000269\|PubMed:17937500, ECO:0000269\|PubMed:18410484, ECO:0000269\|PubMed:23093426}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020188726.1	1e-41	transcription factor MYB46-like
Swissprot	Q9S7L2	7e-14	MYB98_ARATH; Transcription factor MYB98
TrEMBL	M8C9W6	1e-68	M8C9W6_AEGTA; Transcription factor MYB98
STRING	EMT30903	2e-69	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP22654	4	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18770.1	3e-16	myb domain protein 98

Publications ? help Back to Top
Mendes MA, et al. Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis. Development, 2016. 143(15): p. 2780-90 [PMID:27338615]