PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT31604

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

MIKC_MADS

Protein Properties

Length: 196aa MW: 22071.8 Da PI: 5.6164

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT31604	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	46	6.9e-15	1	31	21	51
HHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 21 lKKAeELSvLCdaevaviifsstgklyeyss 51 +KKA EL vLCda+va+i+fsstgk +e++s EMT31604 1 MKKARELTVLCDAQVAIIMFSSTGKYHEFCS 31 8****************************96 PP
2	K-box	65.6	1.8e-22	43	135	1	98
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+ L+++eL+ Leq+++ +lk ++++++q+e+ +kk k qe+ k+L+++l EMT31604 43 YQQAIGTSLWIEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDALEFEELRDLEQNVDAALK-----EYHVITTQTETYKKKVKHSQEAYKNLQQEL 135 67888999****************************************************7.....59**********************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.2E-4	1	32	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.6E-11	1	29	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.57E-19	1	67	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	15.502	1	33	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.6E-14	54	135	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	11.352	56	141	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 196 aa Download sequence Send to blast
MKKARELTVL CDAQVAIIMF SSTGKYHEFC STGTDIKGIF DRYQQAIGTS LWIEQYENMQ 60 RTLSHLKDIN RNLRTEIRQR MGEDLDALEF EELRDLEQNV DAALKEYHVI TTQTETYKKK 120 VKHSQEAYKN LQQELGMRED PAYGFVDNPA AGGWDGVAAV AMGGGSAADM YAFRVVPSQP 180 NLHGMAYGGS HDLRLG

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. {ECO:0000269\|PubMed:12506001, ECO:0000269\|PubMed:12905025, ECO:0000269\|PubMed:14558657}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM502879	0.0	AM502879.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM13 (WM13 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020159050.1	1e-145	MADS-box transcription factor 16
Swissprot	Q944S9	1e-114	MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBL	M8CB61	1e-146	M8CB61_AEGTA; MADS-box transcription factor 16
STRING	EMT31604	1e-147	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5728	35	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	8e-43	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Chen ZX, et al. Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice. Planta, 2006. 223(5): p. 882-90 [PMID:16254725] Zhang Q, et al. Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull. J Genet Genomics, 2007. 34(6): p. 519-26 [PMID:17601611] Yoshida H, et al. superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] Yao SG,Ohmori S,Kimizu M,Yoshida H Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] Xiao H, et al. STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice. Plant J., 2009. 59(5): p. 789-801 [PMID:19453444] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Ohmori S,Tabuchi H,Yatou O,Yoshida H Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation. Breed. Sci., 2012. 62(2): p. 124-32 [PMID:23136523] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Lombardo F, et al. The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]