 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
EMT32161 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
| Family |
bHLH |
| Protein Properties |
Length: 88aa MW: 9784.96 Da PI: 7.5228 |
| Description |
bHLH family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| EMT32161 | genome | BGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | HLH | 22.7 | 1.8e-07 | 15 | 54 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
++N+ +++L++llP++ + +s s L++++ YIksL
EMT32161 15 EVNELMSKLQSLLPNSRRRGSSQASTTKLLKETCSYIKSL 54
68*************77899999****************9 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea (By similarity). {ECO:0000250}. |
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. {ECO:0000269|PubMed:23136524}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AK375631 | 1e-128 | AK375631.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3099P09. |