![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT33035 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 142aa MW: 15570.6 Da PI: 10.5335 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 102.9 | 1.8e-32 | 65 | 123 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
EMT33035 65 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLAEDPRMVITTYEGRHVHS 123
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 9.4E-34 | 50 | 123 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 9.55E-29 | 57 | 124 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.126 | 60 | 125 | IPR003657 | WRKY domain |
| SMART | SM00774 | 5.3E-36 | 65 | 124 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.0E-25 | 66 | 122 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
| GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 142 aa Download sequence Send to blast |
MGINSAAAGG SGGGERSHGS SSAAAGMGVG AVRMKKAAGG GGAKARRKVR EPRFCFKTMS 60 DVDVLDDGYK WRKYGQKVVK NTQHPRSYYR CTQDKCRVKK RVERLAEDPR MVITTYEGRH 120 VHSPSRDDDD AARASAEMSF IW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-27 | 56 | 122 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-27 | 56 | 122 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK108755 | 1e-139 | AK108755.1 Oryza sativa Japonica Group cDNA clone:002-150-F11, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020149424.1 | 1e-101 | probable WRKY transcription factor 13 | ||||
| Swissprot | Q9SVB7 | 4e-58 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
| TrEMBL | A0A3B6GMP6 | 2e-99 | A0A3B6GMP6_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A453E895 | 1e-99 | A0A453E895_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453E8B7 | 2e-99 | A0A453E8B7_AEGTS; Uncharacterized protein | ||||
| TrEMBL | M8C6R6 | 1e-99 | M8C6R6_AEGTA; Putative WRKY transcription factor 13 | ||||
| STRING | EMT33035 | 1e-100 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1138 | 38 | 130 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G39410.1 | 6e-49 | WRKY DNA-binding protein 13 | ||||




