![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS57111.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 64aa MW: 7153.36 Da PI: 10.5741 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 61.5 | 1e-19 | 2 | 35 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C +C tkTp+WR+gp+g+ktLCnaCG+++++ +
EPS57111.1 2 CLHCEITKTPQWRSGPSGPKTLCNACGVRFKSGR 35
99*****************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 11.912 | 1 | 32 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 1.02E-12 | 1 | 48 | No hit | No description |
| SMART | SM00401 | 5.0E-13 | 1 | 46 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 6.65E-16 | 2 | 59 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 2 | 27 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 3.3E-17 | 2 | 36 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 8.3E-16 | 2 | 34 | IPR013088 | Zinc finger, NHR/GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007623 | Biological Process | circadian rhythm | ||||
| GO:0009845 | Biological Process | seed germination | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
KCLHCEITKT PQWRSGPSGP KTLCNACGVR FKSGRLFPEY RPAASPTFVP ALHSNSHKKV 60 IEMR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008347480.2 | 8e-39 | GATA transcription factor 8-like | ||||
| Refseq | XP_009344766.1 | 9e-39 | PREDICTED: GATA transcription factor 8-like | ||||
| Refseq | XP_023929596.1 | 7e-39 | GATA transcription factor 8-like | ||||
| Refseq | XP_024176635.1 | 8e-39 | GATA transcription factor 8-like | ||||
| Swissprot | Q9SV30 | 1e-38 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | A0A2P6SJF0 | 2e-37 | A0A2P6SJF0_ROSCH; GATA transcription factor | ||||
| TrEMBL | A0A498JKE4 | 2e-37 | A0A498JKE4_MALDO; GATA transcription factor | ||||
| TrEMBL | S8BY65 | 3e-40 | S8BY65_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | XP_009344766.1 | 4e-38 | (Pyrus x bretschneideri) | ||||
| STRING | XP_008347480.1 | 3e-38 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3134 | 21 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 5e-41 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




