PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS57246.1
Organism
Genlisea aurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family YABBY
Protein Properties Length: 52aa    MW: 6013.76 Da    PI: 9.1945
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS57246.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY72.71.3e-22138132169
       YABBY 132 fikeeiqrikasnPdishreafsaaaknWahfPkihfg 169
                 f +eeiqrikasnP+ishr+afs+aaknWah+P+ih g
  EPS57246.1   1 FFREEIQRIKASNPEISHRQAFSTAAKNWAHYPDIHIG 38 
                 889*********************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046908.4E-21139IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 52 aa     Download sequence    Send to blast
FFREEIQRIK ASNPEISHRQ AFSTAAKNWA HYPDIHIGMK MEASPPTKTT DQ
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010557447.15e-20PREDICTED: putative axial regulator YABBY 2
SwissprotQ9XFB03e-20YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLS8BYJ55e-31S8BYJ5_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_010557447.12e-19(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.11e-22YABBY family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]