![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS57274.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 100aa MW: 10960.3 Da PI: 11.2046 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 109.2 | 3.2e-34 | 17 | 73 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
d p+YVNaKQy++Il+RRq+Rakle+++kl k+rkpylheSRh+hAl+R Rg+gGrF
EPS57274.1 17 DGPIYVNAKQYHGILRRRQTRAKLEAQNKL-VKTRKPYLHESRHQHALNRVRGTGGRF 73
57****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 6.6E-37 | 15 | 76 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.477 | 16 | 76 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 3.9E-29 | 19 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 5.3E-25 | 19 | 41 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 21 | 41 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 5.3E-25 | 50 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010262 | Biological Process | somatic embryogenesis | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
QMMGGGRVPL PADVPDDGPI YVNAKQYHGI LRRRQTRAKL EAQNKLVKTR KPYLHESRHQ 60 HALNRVRGTG GRFLSTKKQQ KEEASSSAPP PGGGSSSSDS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 2e-23 | 17 | 79 | 2 | 64 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020553567.1 | 2e-46 | nuclear transcription factor Y subunit A-3 isoform X1 | ||||
| Refseq | XP_020553568.1 | 2e-46 | nuclear transcription factor Y subunit A-3 isoform X1 | ||||
| Refseq | XP_020553569.1 | 2e-46 | nuclear transcription factor Y subunit A-3 isoform X1 | ||||
| Refseq | XP_020553570.1 | 2e-46 | nuclear transcription factor Y subunit A-3 isoform X2 | ||||
| Refseq | XP_020553571.1 | 2e-46 | nuclear transcription factor Y subunit A-3 isoform X3 | ||||
| Refseq | XP_020553572.1 | 2e-46 | nuclear transcription factor Y subunit A-3 isoform X5 | ||||
| Refseq | XP_020553573.1 | 2e-46 | nuclear transcription factor Y subunit A-3 isoform X5 | ||||
| Swissprot | Q9LVJ7 | 3e-36 | NFYA6_ARATH; Nuclear transcription factor Y subunit A-6 | ||||
| TrEMBL | S8BS70 | 7e-67 | S8BS70_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Migut.J00955.1.p | 3e-45 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA5009 | 23 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G14020.1 | 3e-36 | nuclear factor Y, subunit A6 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




