PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS57373.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

ZF-HD

Protein Properties

Length: 88aa MW: 9489.61 Da PI: 7.2855

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS57373.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	102.2	3.6e-32	25	80	3	59
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 +vrY eC+kNhAa++Gg+avDGC+Efmp geegt al+CaACgCHRnFHRre+++ EPS57373.1 25 TVRYGECQKNHAANVGGYAVDGCREFMPC-GEEGTEGALTCAACGCHRNFHRRETAS 80 79************************9.999******************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	3.0E-24	1	88	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	7.9E-30	26	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.7E-26	27	77	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.626	28	77	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MKKRHVVLLS SEGQNCANSA YAVRTVRYGE CQKNHAANVG GYAVDGCREF MPCGEEGTEG 60 ALTCAACGCH RNFHRRETAS TEIACDCS

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009596464.1	5e-41	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_009596465.1	5e-41	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_009596466.1	5e-41	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_011098623.1	6e-41	mini zinc finger protein 2
Refseq	XP_011098624.1	6e-41	mini zinc finger protein 2
Swissprot	Q9LJW5	2e-31	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	S8D412	8e-58	S8D412_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009596464.1	2e-40	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	7e-34	mini zinc finger 2

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]