PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS57613.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

M-type_MADS

Protein Properties

Length: 67aa MW: 7705.11 Da PI: 10.6211

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS57613.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	104	5.2e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s EPS57613.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.515	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.68E-39	2	61	No hit	No description
SuperFamily	SSF55455	2.88E-31	2	61	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.2E-34	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.2E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.2E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS 60 SRTLICP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	2e-20	1	61	1	61	MEF2 CHIMERA
6byy_B	2e-20	1	61	1	61	MEF2 CHIMERA
6byy_C	2e-20	1	61	1	61	MEF2 CHIMERA
6byy_D	2e-20	1	61	1	61	MEF2 CHIMERA
6bz1_A	2e-20	1	61	1	61	MEF2 CHIMERA
6bz1_B	2e-20	1	61	1	61	MEF2 CHIMERA
6bz1_C	2e-20	1	61	1	61	MEF2 CHIMERA
6bz1_D	2e-20	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022850778.1	4e-37	MADS-box protein EJ2-like
Swissprot	Q03489	4e-37	AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBL	S8D4L4	1e-40	S8D4L4_9LAMI; Uncharacterized protein
STRING	Lus10017870	2e-37	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.3	2e-39	MIKC_MADS family protein

Publications ? help Back to Top
Immink RG,Gadella TW,Ferrario S,Busscher M,Angenent GC Analysis of MADS box protein-protein interactions in living plant cells. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(4): p. 2416-21 [PMID:11854533] Immink RG, et al. Analysis of the petunia MADS-box transcription factor family. Mol. Genet. Genomics, 2003. 268(5): p. 598-606 [PMID:12589434] Angenent GC,Busscher M,Franken J,Mol JN,van Tunen AJ Differential expression of two MADS box genes in wild-type and mutant petunia flowers. Plant Cell, 1992. 4(8): p. 983-93 [PMID:1356537] Tonaco IA,Borst JW,de Vries SC,Angenent GC,Immink RG In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot., 2006. 57(1): p. 33-42 [PMID:16291798] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]