PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS57998.1
Organism
Genlisea aurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family SBP
Protein Properties Length: 106aa    MW: 12497.4 Da    PI: 10.5377
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS57998.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.31.4e-402499277
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                C v+gC+adls ++eyhrrh+vCe hsk+p v++s++e+rfCqqCsrfh lsefD++krsCr+rL+ hn+rrrk q
  EPS57998.1 24 CLVDGCAADLSLCREYHRRHRVCEPHSKTPIVTISNREHRFCQQCSRFHLLSEFDDGKRSCRKRLDWHNKRRRKIQ 99
                **************************************************************************87 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114130.182198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-3722101IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.8E-322285IPR004333Transcription factor, SBP-box
PfamPF031103.9E-302497IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
KDKMMESSSP SKRRAKIAPP LVQCLVDGCA ADLSLCREYH RRHRVCEPHS KTPIVTISNR  60
EHRFCQQCSR FHLLSEFDDG KRSCRKRLDW HNKRRRKIQP PPDTTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-261897584squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022885332.17e-41teosinte glume architecture 1-like
RefseqXP_022885337.17e-41teosinte glume architecture 1-like
RefseqXP_022885345.17e-41teosinte glume architecture 1-like
RefseqXP_022885354.17e-41teosinte glume architecture 1-like
RefseqXP_022885362.17e-41teosinte glume architecture 1-like
RefseqXP_022885372.17e-41teosinte glume architecture 1-like
RefseqXP_022885384.17e-41teosinte glume architecture 1-like
SwissprotQ6YZE85e-37SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBLS8D5V65e-72S8D5V6_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc05g015840.2.18e-40(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-39SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY
    High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice.
    Theor. Appl. Genet., 2011. 122(8): p. 1489-96
    [PMID:21327937]
  3. Wang S, et al.
    Control of grain size, shape and quality by OsSPL16 in rice.
    Nat. Genet., 2012. 44(8): p. 950-4
    [PMID:22729225]
  4. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  5. Wang S, et al.
    The OsSPL16-GW7 regulatory module determines grain shape and simultaneously improves rice yield and grain quality.
    Nat. Genet., 2015. 47(8): p. 949-54
    [PMID:26147620]
  6. Wang Y, et al.
    A comprehensive meta-analysis of plant morphology, yield, stay-green, and virus disease resistance QTL in maize (Zea mays L.).
    Planta, 2016. 243(2): p. 459-71
    [PMID:26474992]
  7. Lee CM, et al.
    Influence of Multi-Gene Allele Combinations on Grain Size of Rice and Development of a Regression Equation Model to Predict Grain Parameters.
    Rice (N Y), 2015. 8(1): p. 33
    [PMID:26519289]
  8. Bessho-Uehara K, et al.
    Loss of function at RAE2, a previously unidentified EPFL, is required for awnlessness in cultivated Asian rice.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(32): p. 8969-74
    [PMID:27466405]