![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS58210.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 134aa MW: 15073.4 Da PI: 10.3783 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.4 | 5.8e-17 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEd +l+d++++ G+g +W + ++++g++R++k+c++rw++yl
EPS58210.1 14 KGPWSPEEDAKLKDYINKNGTGgNWIALPHKVGLKRCGKSCRLRWLNYL 62
79**********************************************7 PP
| |||||||
| 2 | Myb_DNA-binding | 42.6 | 1.4e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
g ++ eEd+++ + + G++ W+ Ia+ ++ gRt++++k++w++
EPS58210.1 69 GEFSDEEDKIICSLYATIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
789******************.*********.***********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 14.287 | 9 | 62 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.24E-27 | 11 | 109 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.4E-12 | 13 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 6.0E-16 | 14 | 62 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 9.4E-25 | 15 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.41E-9 | 16 | 62 | No hit | No description |
| PROSITE profile | PS51294 | 21.625 | 63 | 117 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.4E-12 | 67 | 115 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.0E-12 | 69 | 111 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.59E-8 | 70 | 113 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-24 | 70 | 117 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008285 | Biological Process | negative regulation of cell proliferation | ||||
| GO:0035987 | Biological Process | endodermal cell differentiation | ||||
| GO:0045597 | Biological Process | positive regulation of cell differentiation | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:2000021 | Biological Process | regulation of ion homeostasis | ||||
| GO:2000067 | Biological Process | regulation of root morphogenesis | ||||
| GO:0048226 | Cellular Component | Casparian strip | ||||
| GO:0000975 | Molecular Function | regulatory region DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIN KNGTGGNWIA LPHKVGLKRC GKSCRLRWLN 60 YLRPNIKHGE FSDEEDKIIC SLYATIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGI 120 SIPASSSQRR NAAV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-26 | 14 | 117 | 7 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012838332.1 | 2e-81 | PREDICTED: transcription factor RAX2-like | ||||
| Refseq | XP_019188955.1 | 3e-81 | PREDICTED: transcription factor MYB44-like | ||||
| Swissprot | Q9FKL2 | 3e-77 | MYB36_ARATH; Transcription factor MYB36 | ||||
| TrEMBL | S8BUC5 | 5e-94 | S8BUC5_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Migut.N02569.1.p | 6e-81 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12 | 24 | 2154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G57620.1 | 1e-79 | myb domain protein 36 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




