![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS58458.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 109aa MW: 12839.9 Da PI: 10.4332 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 58.7 | 1.3e-18 | 19 | 62 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
WT eEd+ll ++v+++ g++Wk++a++++ +Rt+ qc +rwqk+l
EPS58458.1 19 WTHEEDKLLTELVQRYKGKNWKKVAACLP-RRTDVQCLHRWQKVL 62
*****************************.************986 PP
| |||||||
| 2 | Myb_DNA-binding | 48.7 | 1.7e-15 | 68 | 109 | 1 | 43 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
+ +WT+eEd+ +++ v+++G ++W++Ia+ ++ gR +kqc++r
EPS58458.1 68 KSPWTKEEDDCIIKSVEKYGCRRWSAIAKVLP-GRIGKQCRER 109
679*****************************.********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.123 | 8 | 62 | IPR017930 | Myb domain |
| SMART | SM00717 | 5.2E-14 | 15 | 64 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.34E-12 | 19 | 62 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.8E-24 | 19 | 69 | IPR009057 | Homeodomain-like |
| Pfam | PF13921 | 1.5E-18 | 19 | 76 | No hit | No description |
| SuperFamily | SSF46689 | 2.29E-24 | 42 | 109 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.498 | 63 | 109 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.0E-6 | 67 | 109 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.3E-21 | 70 | 109 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 9.05E-12 | 70 | 109 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
CRISEGRFVS VRRSSQAGWT HEEDKLLTEL VQRYKGKNWK KVAACLPRRT DVQCLHRWQK 60 VLNPDLNKSP WTKEEDDCII KSVEKYGCRR WSAIAKVLPG RIGKQCRER |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h88_C | 1e-35 | 19 | 109 | 9 | 142 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 1e-35 | 19 | 109 | 9 | 142 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269|PubMed:17293435, ECO:0000269|PubMed:19279197}. | |||||
| UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269|PubMed:17293435}. | |||||
| UniProt | INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028118929.1 | 1e-49 | transcription factor MYB3R-4-like isoform X2 | ||||
| Swissprot | Q0JHU7 | 2e-41 | MB3R2_ORYSJ; Transcription factor MYB3R-2 | ||||
| Swissprot | Q94FL9 | 3e-41 | MB3R4_ARATH; Transcription factor MYB3R-4 | ||||
| TrEMBL | S8D732 | 7e-74 | S8D732_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Solyc08g080580.2.1 | 8e-48 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA19350 | 3 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G32730.2 | 5e-44 | Homeodomain-like protein | ||||




