PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS59036.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MIKC_MADS

Protein Properties

Length: 114aa MW: 13496.7 Da PI: 10.296

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS59036.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	92.5	2.1e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCda+v +iifs +gk++ey++ EPS59036.1 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVGLIIFSAKGKIFEYAT 59 79***********************************************86 PP
2	K-box	15.8	5.7e-07	87	112	11	36
K-box 11 eakaeslqqelakLkkeienLqreqR 36 ++ s+q e+akLk++++ Lqr+qR EPS59036.1 87 LETPRSWQLEHAKLKARMDVLQRNQR 112 556789******************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.693	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.0E-39	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.09E-33	2	83	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.37E-40	2	75	No hit	No description
PRINTS	PR00404	4.9E-31	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.8E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 114 aa Download sequence Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD ADVGLIIFSA KGKIFEYATD 60 SCMERILERY ERCSYTERHM TEQPPELETP RSWQLEHAKL KARMDVLQRN QRFV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
1tqe_R	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
1tqe_S	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
5f28_C	2e-21	1	79	1	76	MEF2C
5f28_D	2e-21	1	79	1	76	MEF2C
6byy_A	2e-21	1	79	1	76	MEF2 CHIMERA
6byy_B	2e-21	1	79	1	76	MEF2 CHIMERA
6byy_C	2e-21	1	79	1	76	MEF2 CHIMERA
6byy_D	2e-21	1	79	1	76	MEF2 CHIMERA
6bz1_A	1e-21	1	79	1	76	MEF2 CHIMERA
6bz1_B	1e-21	1	79	1	76	MEF2 CHIMERA
6bz1_C	1e-21	1	79	1	76	MEF2 CHIMERA
6bz1_D	1e-21	1	79	1	76	MEF2 CHIMERA
6c9l_A	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
6c9l_B	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
6c9l_C	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
6c9l_D	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
6c9l_E	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
6c9l_F	1e-21	1	79	1	76	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011086917.1	8e-64	truncated transcription factor CAULIFLOWER A
Refseq	XP_011086918.1	8e-64	truncated transcription factor CAULIFLOWER A
Swissprot	Q42429	6e-60	AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBL	S8C3S0	1e-79	S8C3S0_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009792071.1	7e-61	(Nicotiana sylvestris)
STRING	XP_009625854.1	7e-61	(Nicotiana tomentosiformis)
STRING	Migut.D01622.1.p	4e-61	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA499	23	97

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60910.1	1e-55	AGAMOUS-like 8

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Kang SG,Hannapel DJ Nucleotide sequences of novel potato (Solanum tuberosum L.) MADS-box cDNAs and their expression in vegetative organs. Gene, 1995. 166(2): p. 329-30 [PMID:8543185]