PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS59077.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

WRKY

Protein Properties

Length: 91aa MW: 11002.7 Da PI: 10.7476

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS59077.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	105.5	2.7e-33	31	89	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++++prsYYrCt +C+vkk+ver a+dp++v++tYeg+H h+ EPS59077.1 31 LDDGYKWRKYGQKVVKNTQHPRSYYRCTADNCRVKKRVERLADDPRMVITTYEGRHVHS 89 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.2E-34	16	89	IPR003657	WRKY domain
SuperFamily	SSF118290	1.07E-29	23	89	IPR003657	WRKY domain
PROSITE profile	PS50811	29.471	26	91	IPR003657	WRKY domain
SMART	SM00774	7.4E-37	31	90	IPR003657	WRKY domain
Pfam	PF03106	3.6E-26	32	88	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:1901141	Biological Process	regulation of lignin biosynthetic process
GO:1904369	Biological Process	positive regulation of sclerenchyma cell differentiation
GO:0001046	Molecular Function	core promoter sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
IDVKKNKGIR RRRQMREPRF CFKTMSDVDV LDDGYKWRKY GQKVVKNTQH PRSYYRCTAD 60 NCRVKKRVER LADDPRMVIT TYEGRHVHSP S

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-28	22	88	8	74	Probable WRKY transcription factor 4
2lex_A	4e-28	22	88	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001237342.2	7e-54	WRKY transcription factor 40
Refseq	XP_011100913.2	7e-54	probable WRKY transcription factor 13
Refseq	XP_028246516.1	7e-54	probable WRKY transcription factor 13 isoform X1
Swissprot	Q9SVB7	4e-50	WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBL	S8DI39	5e-61	S8DI39_9LAMI; Uncharacterized protein (Fragment)
STRING	GLYMA08G15210.1	3e-53	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA10376	21	26

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G39410.1	1e-52	WRKY DNA-binding protein 13

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]