![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS59231.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 147aa MW: 17139.2 Da PI: 9.4146 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 101.4 | 1.2e-31 | 3 | 79 | 51 | 128 |
NAM 51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+k+++++w+fFs+rd+ky++g r+nratk gyWkatgkd+ + g+ glkktLvfy+grap+ge+tdWvmhey++
EPS59231.1 3 LKTGDRQWFFFSPRDRKYPNGGRSNRATKYGYWKATGKDRVISY-AGRPAGLKKTLVFYRGRAPNGERTDWVMHEYTM 79
567899************************************99.999****************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 36.755 | 1 | 102 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 2.75E-36 | 4 | 102 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.6E-15 | 9 | 78 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 147 aa Download sequence Send to blast |
SKLKTGDRQW FFFSPRDRKY PNGGRSNRAT KYGYWKATGK DRVISYAGRP AGLKKTLVFY 60 RGRAPNGERT DWVMHEYTMD ESELKRCVDV KEYYALYKAF KKSGPGPKNG EQYGAPFNEE 120 DWENDDLQVQ CFDFIEKPVK HSDETAP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 2e-30 | 6 | 108 | 69 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-30 | 6 | 108 | 69 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-30 | 6 | 108 | 69 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-30 | 6 | 108 | 69 | 171 | NO APICAL MERISTEM PROTEIN |
| 4dul_A | 2e-30 | 6 | 108 | 69 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 2e-30 | 6 | 108 | 69 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011074130.1 | 2e-77 | NAC domain-containing protein 17-like | ||||
| Swissprot | Q9XIC5 | 2e-67 | NAC17_ARATH; NAC domain-containing protein 17 | ||||
| TrEMBL | S8C481 | 1e-106 | S8C481_9LAMI; Nam-like protein 7 (Fragment) | ||||
| STRING | XP_002527114.1 | 1e-73 | (Ricinus communis) | ||||
| STRING | Migut.N02932.1.p | 2e-73 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3212 | 24 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G34190.1 | 8e-70 | NAC domain containing protein 17 | ||||




