![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS59263.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 114aa MW: 13088.6 Da PI: 9.8069 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 90.2 | 1.8e-28 | 16 | 73 | 5 | 62 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
l+cprC s +tkf y+nn++ +qPr++C++C+r Wt+GG lrn+P Gg +++ ++ss
EPS59263.1 16 PLQCPRCGSLDTKFRYFNNHNFAQPRHYCRTCKRQWTAGGNLRNIPAGGKTKQTEASS 73
579**********************************************999887765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 6.0E-16 | 10 | 70 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 23.589 | 17 | 71 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.5E-27 | 17 | 70 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
ETEENQPKPL EQVPVPLQCP RCGSLDTKFR YFNNHNFAQP RHYCRTCKRQ WTAGGNLRNI 60 PAGGKTKQTE ASSSRTNHTF RLAQTSLREG EPGKIHQPPQ SFERSNLQWI TDLP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012846307.1 | 3e-25 | PREDICTED: dof zinc finger protein DOF3.2-like | ||||
| Swissprot | Q9M2U1 | 6e-21 | DOF36_ARATH; Dof zinc finger protein DOF3.6 | ||||
| TrEMBL | S8D963 | 1e-79 | S8D963_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Migut.N01984.1.p | 1e-24 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA16144 | 5 | 6 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G55370.1 | 3e-23 | OBF-binding protein 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




