PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS59407.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

NAC

Protein Properties

Length: 171aa MW: 19699.5 Da PI: 9.6359

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS59407.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	165.3	2.1e-51	1	128	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 lp GfrFhPtdeelv +yLk+kv+g +l++ ++i+++d+yk++Pw+Lp k+ +e+ wyfF++r++ky++g r+nra+ sgyWkatg+dk+++++ + + EPS59407.1 1 LPSGFRFHPTDEELVIDYLKRKVAGAPLPA-SIIADIDLYKFDPWELPDKALFGEHVWYFFTPRERKYPNGARPNRAAISGYWKATGTDKSIMAEgGAS 98 699*************************.89***********77778999**********************************95566 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 vg+kk Lvfy+g+ pkg kt+W+mheyrl EPS59407.1 99 RVGVKKALVFYTGKPPKGLKTNWIMHEYRL 128 7*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	59.873	1	159	IPR003441	NAC domain
SuperFamily	SSF101941	8.5E-61	1	159	IPR003441	NAC domain
Pfam	PF02365	1.1E-27	2	128	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 171 aa Download sequence Send to blast
LPSGFRFHPT DEELVIDYLK RKVAGAPLPA SIIADIDLYK FDPWELPDKA LFGEHVWYFF 60 TPRERKYPNG ARPNRAAISG YWKATGTDKS IMAEGGASRV GVKKALVFYT GKPPKGLKTN 120 WIMHEYRLVD NNPGPIPEFL SRRDSSRLDE WVLCRIYEKR AASRPDHEYR D

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-73	1	164	17	170	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-73	1	164	17	170	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-73	1	164	17	170	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-73	1	164	17	170	NO APICAL MERISTEM PROTEIN
3swm_A	2e-73	1	164	20	173	NAC domain-containing protein 19
3swm_B	2e-73	1	164	20	173	NAC domain-containing protein 19
3swm_C	2e-73	1	164	20	173	NAC domain-containing protein 19
3swm_D	2e-73	1	164	20	173	NAC domain-containing protein 19
3swp_A	2e-73	1	164	20	173	NAC domain-containing protein 19
3swp_B	2e-73	1	164	20	173	NAC domain-containing protein 19
3swp_C	2e-73	1	164	20	173	NAC domain-containing protein 19
3swp_D	2e-73	1	164	20	173	NAC domain-containing protein 19
4dul_A	2e-73	1	164	17	170	NAC domain-containing protein 19
4dul_B	2e-73	1	164	17	170	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000305}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By Jasmonic acid (JA). {ECO:0000269\|PubMed:16805732}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011095244.1	7e-88	NAC transcription factor 56-like
Swissprot	Q9LD44	9e-83	NAC56_ARATH; NAC transcription factor 56
TrEMBL	S8DIV7	1e-122	S8DIV7_9LAMI; Uncharacterized protein (Fragment)
STRING	Migut.M00864.1.p	3e-86	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1814	24	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15510.1	4e-85	NAC domain containing protein 2

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]