PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS59489.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

M-type_MADS

Protein Properties

Length: 103aa MW: 11996.7 Da PI: 10.2448

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS59489.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.9	4.1e-31	26	76	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtf+kRrng+lKKA+ELSvLCdaev++i+fss+g+lyey++ EPS59489.1 26 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYAN 76 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.744	18	78	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.9E-39	18	77	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.05E-38	19	79	No hit	No description
SuperFamily	SSF55455	2.35E-31	19	90	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	20	74	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-33	20	40	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-26	27	74	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-33	40	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-33	55	76	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MAFTSQESGE YSCSSRRNGR GKIEIKRIEN TTSRQVTFCK RRNGLLKKAY ELSVLCDAEV 60 SLIVFSSRGR LYEYANNSFY RQQTQFYFQH VILSSSHLLK LPK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
1tqe_Q	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
1tqe_R	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
1tqe_S	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
6c9l_A	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
6c9l_B	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
6c9l_C	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
6c9l_D	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
6c9l_E	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
6c9l_F	7e-20	19	81	2	64	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:19956801}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269\|PubMed:10198637, ECO:0000269\|PubMed:11058164, ECO:0000269\|PubMed:1675158, ECO:0000269\|PubMed:17794879, ECO:0000269\|PubMed:18281509, ECO:0000269\|PubMed:19783648, ECO:0000269\|PubMed:9783581}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011082936.1	2e-40	floral homeotic protein AGAMOUS
Swissprot	P17839	2e-37	AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBL	S8BYL8	3e-69	S8BYL8_9LAMI; Uncharacterized protein
STRING	XP_007141377.1	7e-37	(Phaseolus vulgaris)
STRING	Lus10002763	5e-37	(Linum usitatissimum)
STRING	XP_009612078.1	7e-37	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	6e-39	MIKC_MADS family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Huang Z, et al. APETALA2 antagonizes the transcriptional activity of AGAMOUS in regulating floral stem cells in Arabidopsis thaliana. New Phytol., 2017. 215(3): p. 1197-1209 [PMID:27604611] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Uemura A, et al. Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis. Plant Reprod, 2018. 31(1): p. 89-105 [PMID:29218596]