![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS59635.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 145aa MW: 16119.4 Da PI: 8.6895 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 104.8 | 5.1e-33 | 22 | 76 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprlrWt +LHerFv+av+qLGG+ kAtPk+il++m+vkgLtl h+kSHLQkYRl
EPS59635.1 22 KPRLRWTADLHERFVDAVTQLGGATKATPKAILRTMGVKGLTLFHLKSHLQKYRL 76
79****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.579 | 19 | 79 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.1E-32 | 19 | 77 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 6.63E-17 | 22 | 78 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.2E-24 | 22 | 77 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 2.7E-8 | 24 | 75 | IPR001005 | SANT/Myb domain |
| Pfam | PF14379 | 9.3E-8 | 117 | 138 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
PAYGQRLPCG EPCMVQLTSD PKPRLRWTAD LHERFVDAVT QLGGATKATP KAILRTMGVK 60 GLTLFHLKSH LQKYRLGKQS GKELGESSKD GVYAMDSPLS SDSHQNLHSS DMNDGYEVKE 120 ALRAQMEVQS QLHLQVEVSP LYNKI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4r_A | 2e-20 | 22 | 78 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 2e-20 | 22 | 78 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 2e-20 | 22 | 78 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 2e-20 | 22 | 78 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011086304.1 | 2e-72 | protein PHR1-LIKE 2-like | ||||
| Swissprot | Q94A57 | 3e-54 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
| TrEMBL | S8BYF1 | 1e-104 | S8BYF1_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Migut.M01478.1.p | 9e-72 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA9764 | 20 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24120.1 | 1e-56 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




