![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS59667.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 146aa MW: 16745.3 Da PI: 9.0964 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 85.5 | 3.2e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien rqvtfskRr g+lKKA EL vLCdaevaviifsstgk+y+++s
EPS59667.1 9 KKIENVNSRQVTFSKRRGGLLKKARELAVLCDAEVAVIIFSSTGKMYDFAS 59
68***********************************************86 PP
| |||||||
| 2 | K-box | 45.5 | 3.2e-16 | 92 | 146 | 15 | 69 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
+++ e++ Lk+eie L+ qR++ G+dLe L++ +L+ Le+qL +++ ++++kK
EPS59667.1 92 HEYSSEVKHLKNEIEALKLRQRQMTGKDLEGLTYSDLHDLENQLMEGILSVKDKK 146
57999************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.0E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.127 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.76E-41 | 2 | 74 | No hit | No description |
| SuperFamily | SSF55455 | 3.14E-32 | 2 | 74 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.7E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.0E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.7E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.7E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene3D | G3DSA:1.10.1280.10 | 6.6E-4 | 62 | 139 | IPR008922 | Uncharacterised domain, di-copper centre |
| PROSITE profile | PS51297 | 9.618 | 91 | 146 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.4E-12 | 91 | 146 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009555 | Biological Process | pollen development | ||||
| GO:0009910 | Biological Process | negative regulation of flower development | ||||
| GO:0048577 | Biological Process | negative regulation of short-day photoperiodism, flowering | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MGRGKIEIKK IENVNSRQVT FSKRRGGLLK KARELAVLCD AEVAVIIFSS TGKMYDFASS 60 RMDQILARYN QSNECLEIVT VEHAAEQVKF RHEYSSEVKH LKNEIEALKL RQRQMTGKDL 120 EGLTYSDLHD LENQLMEGIL SVKDKK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-24 | 1 | 74 | 1 | 74 | MEF2C |
| 5f28_B | 2e-24 | 1 | 74 | 1 | 74 | MEF2C |
| 5f28_C | 2e-24 | 1 | 74 | 1 | 74 | MEF2C |
| 5f28_D | 2e-24 | 1 | 74 | 1 | 74 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011075339.1 | 4e-70 | MADS-box transcription factor 23 | ||||
| Swissprot | Q9M2K8 | 1e-47 | AGL18_ARATH; Agamous-like MADS-box protein AGL18 | ||||
| TrEMBL | S8DJJ6 | 1e-102 | S8DJJ6_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | XP_009591403.1 | 1e-55 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA8775 | 22 | 26 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G57390.1 | 6e-50 | AGAMOUS-like 18 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




