PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS59701.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MYB_related

Protein Properties

Length: 168aa MW: 19164.6 Da PI: 9.8088

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS59701.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	45.6	1.7e-14	17	61	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r rW++ E++++v+a k++G W+ I +++ ++t+ q++s+ qk+ EPS59701.1 17 RERWSEAEHLRFVEALKLYGRS-WRQIEEHVA-TKTAIQIRSHAQKF 61 78****************55.*****.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	4.64E-15	11	66	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.077	12	66	IPR017930	Myb domain
TIGRFAMs	TIGR01557	7.4E-16	15	64	IPR006447	Myb domain, plants
SMART	SM00717	7.8E-11	16	64	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-7	17	57	IPR009057	Homeodomain-like
Pfam	PF00249	2.8E-11	17	60	IPR001005	SANT/Myb domain
CDD	cd00167	1.84E-8	19	62	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007623	Biological Process	circadian rhythm
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0009845	Biological Process	seed germination
GO:0009909	Biological Process	regulation of flower development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 168 aa Download sequence Send to blast
MGSDSKVRKP YTITKQRERW SEAEHLRFVE ALKLYGRSWR QIEEHVATKT AIQIRSHAQK 60 FFAKVTRDSG VCRGEWSLNP DDIPPPRPKK KPVHPYPRKR SSSSAKEVEN VSFLDGDDNK 120 YSPSSVLSPL ASSDNLDVDK NSPNTDDLFA RIPSPDDKFA TVIIIIHY

Functional Description ? help Back to Top
Source	Description
UniProt	Positive regulator for cold-responsive gene expression and cold tolerance. Part of a regulatory feedback loop that controls a subset of the circadian outputs and modulates the central oscillator. Negatively self-regulates its own expression. {ECO:0000269\|PubMed:17587236, ECO:0000269\|PubMed:23371945}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Up-regulated transiently by light. {ECO:0000269\|PubMed:17587236, ECO:0000269\|PubMed:19805390}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020548212.1	2e-42	protein REVEILLE 7-like isoform X1
Refseq	XP_020548213.1	2e-42	protein REVEILLE 7-like isoform X1
Refseq	XP_020548214.1	2e-42	protein REVEILLE 7-like isoform X1
Refseq	XP_020548215.1	2e-42	protein REVEILLE 7-like isoform X2
Swissprot	F4K5X6	7e-42	RVE2_ARATH; Protein REVEILLE 2
TrEMBL	S8C5I1	1e-120	S8C5I1_9LAMI; Uncharacterized protein
STRING	Bra039503.1-P	3e-41	(Brassica rapa)
STRING	Migut.O00255.1.p	3e-41	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA7447	21	27

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G37260.1	9e-36	MYB_related family protein

Publications ? help Back to Top
Chaudhury A,Okada K,Raikhel NV,Shinozaki K,Sundaresan V V A weed reaches new heights down under Plant Cell, 1999. 11(10): p. 1817-26 [PMID:10521514] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jiang Z,Xu G,Jing Y,Tang W,Lin R Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis. Nat Commun, 2016. 7: p. 12377 [PMID:27506149]