PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS60218.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

bZIP

Protein Properties

Length: 100aa MW: 12070.9 Da PI: 11.9663

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS60218.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	35.4	2.3e-11	4	48	3	47
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 e +r rr+ +NRe+ArrsR+RK++ e L++++ +L + N +L EPS60218.1 4 EEQRMRRMKSNRESARRSRLRKRKHFESLRDEANVLRGVNVELMI 48 67899***********************************99853 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	8.9E-8	2	66	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.7E-7	3	51	No hit	No description
Pfam	PF00170	1.7E-9	3	49	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.094	4	46	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.06E-9	7	57	No hit	No description
PROSITE pattern	PS00036	0	9	24	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 100 aa Download sequence Send to blast
AAEEEQRMRR MKSNRESARR SRLRKRKHFE SLRDEANVLR GVNVELMIRR RLTESQNQCV 60 AAENYRLRAE AEMLRRRLSD VRRTLILRQL NCSRAWPCST

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	18	24	RRSRLRK

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009362602.1	1e-23	PREDICTED: bZIP transcription factor 11
TrEMBL	S8DBU9	2e-62	S8DBU9_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009362602.1	4e-23	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2820	22	51

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]