![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS60588.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 119aa MW: 13821.6 Da PI: 10.3479 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 134.7 | 2.9e-42 | 25 | 102 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
+CqvegC+ dl++ak+yhrrh++Cevhsk+p+v+v+g+e+rfCqqCsrfhelsefD++krsCrrrL++hn+rrr+ q+
EPS60588.1 25 CCQVEGCNLDLKSAKDYHRRHRICEVHSKSPKVIVAGMERRFCQQCSRFHELSEFDDKKRSCRRRLSDHNARRRRVQP 102
6**************************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.0E-35 | 20 | 87 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 32.659 | 23 | 100 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.96E-39 | 24 | 105 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.0E-33 | 26 | 99 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
SSPHPDSSTP SKRSRASYHH IQNPCCQVEG CNLDLKSAKD YHRRHRICEV HSKSPKVIVA 60 GMERRFCQQC SRFHELSEFD DKKRSCRRRL SDHNARRRRV QPESFQLKTP ALSSALYSG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 7e-31 | 26 | 99 | 11 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 81 | 98 | KKRSCRRRLSDHNARRRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023874058.1 | 1e-59 | LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 3 | ||||
| Swissprot | A2X0Q6 | 2e-43 | SPL3_ORYSI; Squamosa promoter-binding-like protein 3 | ||||
| Swissprot | A3A2Z8 | 2e-43 | SPL3_ORYSJ; Squamosa promoter-binding-like protein 3 | ||||
| TrEMBL | S8DCQ4 | 4e-81 | S8DCQ4_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | XP_010252163.1 | 2e-55 | (Nelumbo nucifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G43270.3 | 1e-44 | squamosa promoter binding protein-like 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




