PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS61199.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9159.82 Da PI: 9.8346

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS61199.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	73.2	2.2e-23	11	59	3	51
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 i n++ rq+ f+kR++ i+KKA+EL vLCd+eva+i+fs+ g l +++s EPS61199.1 11 ILNDTSRQIAFTKRKESIIKKAHELAVLCDTEVALIMFSPGGSLVTFAS 59 789********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	24.221	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.0E-26	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.35E-25	2	76	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.5E-19	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.5E-20	11	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.5E-19	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.5E-19	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MGRKKTELCP ILNDTSRQIA FTKRKESIIK KAHELAVLCD TEVALIMFSP GGSLVTFASK 60 GSVEDIFLRF LNMHPEAKRM Y

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_R	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_S	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6byy_A	2e-16	1	70	1	69	MEF2 CHIMERA
6byy_B	2e-16	1	70	1	69	MEF2 CHIMERA
6byy_C	2e-16	1	70	1	69	MEF2 CHIMERA
6byy_D	2e-16	1	70	1	69	MEF2 CHIMERA
6bz1_A	2e-16	1	70	1	69	MEF2 CHIMERA
6bz1_B	2e-16	1	70	1	69	MEF2 CHIMERA
6bz1_C	2e-16	1	70	1	69	MEF2 CHIMERA
6bz1_D	2e-16	1	70	1	69	MEF2 CHIMERA
6c9l_A	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_B	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_C	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_D	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_E	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_F	2e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012830480.1	2e-26	PREDICTED: MADS-box protein SOC1-like isoform X2
Refseq	XP_020549788.1	3e-26	agamous-like MADS-box protein AGL104
Swissprot	Q9LM46	6e-21	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	S8C3F7	3e-53	S8C3F7_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009623377.1	2e-25	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22130.1	3e-23	AGAMOUS-like 104

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]