PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS61345.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

NAC

Protein Properties

Length: 162aa MW: 18657.4 Da PI: 10.0413

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS61345.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	167.3	5.2e-52	3	127	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 lp GfrFhPtdeelv +yL++k++g+++++ +vi+e+diyk++PwdLp + +ekewyfFs+rd+ky++g+r+nra+ +g+Wkatg dk+v + ++ EPS61345.1 3 LPSGFRFHPTDEELVEHYLCRKCTGQNISA-QVIAEIDIYKFDPWDLPGMSCYGEKEWYFFSPRDRKYPNGSRPNRAAGNGFWKATGVDKPVGK--PKT 98 699*************************.99***********65556899********************************98..778 PP NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128 +kk Lvfy g+ap+g+kt+W+mheyrl EPS61345.1 99 LAIKKALVFYAGKAPNGVKTNWIMHEYRL 127 9************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.18E-61	1	155	IPR003441	NAC domain
PROSITE profile	PS51005	58.396	3	155	IPR003441	NAC domain
Pfam	PF02365	5.2E-27	4	127	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 162 aa Download sequence Send to blast
MNLPSGFRFH PTDEELVEHY LCRKCTGQNI SAQVIAEIDI YKFDPWDLPG MSCYGEKEWY 60 FFSPRDRKYP NGSRPNRAAG NGFWKATGVD KPVGKPKTLA IKKALVFYAG KAPNGVKTNW 120 IMHEYRLANV DRSANGGKRN KLRLDEWVLC RIYNKKGAME RH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-81	1	161	13	174	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in disease resistance response (PubMed:16115070, PubMed:19625399). May function as repressor of pathogenesis-related proteins (PubMed:16115070). May function in the regulation of host basal defense responses against viral infection (PubMed:19625399). Transcriptional activator involved in responses to wounding and infection with tobamovirus (TMV) (PubMed:22937923). Binds to the DNA sequences 5'-AAAATATCT-3' and 5'AGATTTTT-3' of CYP734A1/BAS1 and CYP72C1/SOB7 promoters, respectively. Acts as suppressor of the brassinosteroid (BR)-inactivating enzymes CYP734A1/BAS1 and CYP72C1/SOB7, and prevents their expression in almost all tissues. Plays a central role in integrating BR homeostasis and seedling development. Regulates the spatial regulation of BR homeostasis and participates in the regulation of hypocotyl elongation and root growth by suppressing BR catabolism. Mediates connection between BR catabolism and photomorphogenesis (PubMed:26493403). Binds to, and transactivates the promoter of the auxin biosynthetic gene NIT2 (PubMed:22965747). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16115070, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:19625399, ECO:0000269\|PubMed:22937923, ECO:0000269\|PubMed:22965747, ECO:0000269\|PubMed:26493403, ECO:0000269\|PubMed:26518251}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding, salicylic acid (SA), methyl jasmonate, drought stress, dark and sucrose starvation (PubMed:16115070). Induced by chitin elicitor (chitooctaose) (PubMed:17722694). Induced by salicylic acid and infection with tobamovirus (TMV) (PubMed:19625399). By indole-3-acetonitrile, salicylic acid (SA), sodium nitroprusside (SNP), salt stress and drought stress (PubMed:22965747). Down-regulated by brassinosteroid (BR) and transition from dark to white light (PubMed:26493403). {ECO:0000269\|PubMed:16115070, ECO:0000269\|PubMed:17722694, ECO:0000269\|PubMed:19625399, ECO:0000269\|PubMed:22965747, ECO:0000269\|PubMed:26493403}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022844703.1	1e-102	NAC domain-containing protein 2-like
Swissprot	Q9C598	1e-100	NAC81_ARATH; Protein ATAF2
TrEMBL	S8C3H8	1e-119	S8C3H8_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_010452896.1	4e-99	(Camelina sativa)
STRING	XP_010491536.1	5e-99	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1239	24	81

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G08790.1	1e-103	NAC family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251]