PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61914.1
Organism
Genlisea aurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GATA
Protein Properties Length: 73aa    MW: 8330.73 Da    PI: 11.0107
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61914.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.83.4e-19740134
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                C +C + kTp+WR+gp+g+ktLCnaCG++y+  +
  EPS61914.1  7 CLHCDAEKTPQWRKGPSGPKTLCNACGVRYKAGR 40
                99*****************************877 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.2E-16151IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.097137IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.76E-16465No hitNo description
Gene3DG3DSA:3.30.50.103.2E-16539IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.57E-11653No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF003201.2E-16741IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
GIERRKCLHC DAEKTPQWRK GPSGPKTLCN ACGVRYKAGR LVPEYRPAAS PTFVVTKHSN  60
SHRKVMLLRQ RKE
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394835.12e-39GATA transcription factor 12
RefseqXP_010493840.12e-39PREDICTED: GATA transcription factor 12-like
SwissprotP697817e-39GAT12_ARATH; GATA transcription factor 12
TrEMBLS8C5C03e-47S8C5C0_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_006394835.17e-39(Eutrema salsugineum)
STRINGXP_010493840.19e-39(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.13e-41GATA transcription factor 12
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]