PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS62609.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MYB_related

Protein Properties

Length: 73aa MW: 8517.83 Da PI: 11.3092

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS62609.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.2	2.9e-16	2	47	2	47
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++WT+eE+++++++ +lG g+Wk I++ + k+R+ q+ s+ qky EPS62609.1 2 MPWTEEEHKKFLEGLDKLGRGNWKGISKIFVKTRSSTQVASHAQKY 47 69*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	4.2E-7	1	50	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.124	1	52	IPR017930	Myb domain
SuperFamily	SSF46689	3.59E-18	2	53	IPR009057	Homeodomain-like
Pfam	PF00249	8.1E-14	2	47	IPR001005	SANT/Myb domain
TIGRFAMs	TIGR01557	3.4E-18	2	51	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	4.0E-11	3	47	IPR009057	Homeodomain-like
CDD	cd00167	3.76E-9	3	48	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
GMPWTEEEHK KFLEGLDKLG RGNWKGISKI FVKTRSSTQV ASHAQKYFLR KSSMDKRKRR 60 NSVFDVRIVS AFS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000269\|PubMed:12172034}.
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000250\|UniProtKB:Q7XC51}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by sucrose. Slightly repressed by gibberellic acid (GA). {ECO:0000269\|PubMed:12172034}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006601240.2	4e-30	transcription factor MYBS3, partial
Swissprot	B8BI93	3e-29	MYBS2_ORYSI; Transcription factor MYBS2
Swissprot	Q7XC51	3e-29	MYBS2_ORYSJ; Transcription factor MYBS2
TrEMBL	S8C745	4e-46	S8C745_9LAMI; Uncharacterized protein (Fragment)
STRING	Traes_1AL_F7D2C31DB.1	7e-30	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3385	21	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G61620.1	2e-30	MYB_related family protein

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]