PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS62937.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MYB_related

Protein Properties

Length: 51aa MW: 5550.33 Da PI: 9.3534

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS62937.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	33.9	7.2e-11	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEde+lv+++k G g+W++ ++ g EPS62937.1 14 KGKWTAEEDEKLVNYIKANGDGSWRSLPKNAG 45 79************************999887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.3E-13	5	49	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.08E-8	8	45	IPR009057	Homeodomain-like
PROSITE profile	PS51294	13.657	9	51	IPR017930	Myb domain
Pfam	PF00249	1.1E-8	14	45	IPR001005	SANT/Myb domain
CDD	cd00167	4.10E-5	16	45	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 51 aa Download sequence Send to blast
MGRTPCCDKI GLKKGKWTAE EDEKLVNYIK ANGDGSWRSL PKNAGAERVA G

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269\|PubMed:19211694, ECO:0000269\|PubMed:22575450, ECO:0000269\|PubMed:25060192}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269\|PubMed:19211694, ECO:0000269\|PubMed:25060192}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011071652.1	6e-23	transcription factor MYB14
Swissprot	Q9M0J5	5e-20	MYB41_ARATH; Transcription factor MYB41
TrEMBL	S8DT12	4e-29	S8DT12_9LAMI; Uncharacterized protein
STRING	Migut.N00057.1.p	2e-22	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA15484	7	7

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28110.1	2e-22	myb domain protein 41

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]