![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS63291.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 118aa MW: 13524.6 Da PI: 10.1692 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 51.3 | 2.7e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEd +l d ++++G+g +W + +++ g++R++k+c++rw++yl
EPS63291.1 14 KGPWSPEEDAKLRDFIERFGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
79**********************************************7 PP
| |||||||
| 2 | Myb_DNA-binding | 41 | 4.3e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
g ++ eEd ++ + + G++ W+ Ia+ ++ gRt++++k++w++
EPS63291.1 69 GEFSDEEDRIICSLYAAIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
789******************.*********.***********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.492 | 9 | 62 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.08E-28 | 11 | 109 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.7E-11 | 13 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.3E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 6.4E-25 | 15 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.26E-8 | 16 | 62 | No hit | No description |
| PROSITE profile | PS51294 | 22.092 | 63 | 117 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.2E-12 | 67 | 115 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 9.4E-12 | 69 | 111 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-24 | 70 | 117 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.53E-8 | 70 | 113 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MGRAPCCDKA NVKKGPWSPE EDAKLRDFIE RFGTGGNWIA LPQKAGLKRC GKSCRLRWLN 60 YLRPNIKHGE FSDEEDRIIC SLYAAIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 4e-28 | 14 | 117 | 7 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019188955.1 | 1e-83 | PREDICTED: transcription factor MYB44-like | ||||
| Refseq | XP_023749495.1 | 5e-84 | transcription factor RAX2-like | ||||
| Swissprot | Q9FKL2 | 2e-76 | MYB36_ARATH; Transcription factor MYB36 | ||||
| TrEMBL | A0A2J6JGE0 | 1e-82 | A0A2J6JGE0_LACSA; Uncharacterized protein | ||||
| STRING | XP_010684035.1 | 7e-82 | (Beta vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12 | 24 | 2154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G57620.1 | 1e-78 | myb domain protein 36 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




