PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS63592.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

NAC

Protein Properties

Length: 184aa MW: 21721.7 Da PI: 9.6459

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS63592.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	161	4.5e-50	15	140	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rdkky++g+r+nr+t+sgyWkatg d+ + s++ + + EPS63592.1 15 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDKKYRNGDRPNRVTTSGYWKATGADRMIRSENFQSI 112 79*************************.89***********8778899***************************************** PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 glkktLvfy+g+apkg +t W+m+eyrl EPS63592.1 113 GLKKTLVFYSGKAPKGIRTCWIMNEYRL 140 ************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	54.489	14	161	IPR003441	NAC domain
SuperFamily	SSF101941	1.44E-55	14	160	IPR003441	NAC domain
Pfam	PF02365	2.1E-25	16	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 184 aa Download sequence Send to blast
ESHPDDDFHQ HDLVMPGFRF HPTEEELVEF YLRRKVEGKR FNVELITFLD LYRYDPWELP 60 ALAAIGEKEW FFYVPRDKKY RNGDRPNRVT TSGYWKATGA DRMIRSENFQ SIGLKKTLVF 120 YSGKAPKGIR TCWIMNEYRL PLHETERLQK GEISLCRVYK RAGVEDRPSL PRSIPSSRSS 180 KSNS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-55	16	161	19	165	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-55	16	161	19	165	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-55	16	161	19	165	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-55	16	161	19	165	NO APICAL MERISTEM PROTEIN
3swm_A	4e-55	16	161	22	168	NAC domain-containing protein 19
3swm_B	4e-55	16	161	22	168	NAC domain-containing protein 19
3swm_C	4e-55	16	161	22	168	NAC domain-containing protein 19
3swm_D	4e-55	16	161	22	168	NAC domain-containing protein 19
3swp_A	4e-55	16	161	22	168	NAC domain-containing protein 19
3swp_B	4e-55	16	161	22	168	NAC domain-containing protein 19
3swp_C	4e-55	16	161	22	168	NAC domain-containing protein 19
3swp_D	4e-55	16	161	22	168	NAC domain-containing protein 19
4dul_A	4e-55	16	161	19	165	NAC domain-containing protein 19
4dul_B	4e-55	16	161	19	165	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00257	DAP	Transfer from AT2G02450	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004301581.1	1e-118	PREDICTED: NAC domain-containing protein 48
Refseq	XP_009626107.1	1e-118	PREDICTED: NAC domain-containing protein 35-like isoform X1
Swissprot	Q9ZVP8	1e-106	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	S8DUK5	1e-134	S8DUK5_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009626107.1	1e-118	(Nicotiana tomentosiformis)
STRING	XP_004301581.1	1e-117	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3888	24	46

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.2	1e-103	NAC domain containing protein 35

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]