PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS63761.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

bZIP

Protein Properties

Length: 112aa MW: 12712.5 Da PI: 9.5855

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS63761.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	33.1	1.2e-10	33	93	4	64
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 kr++r NR +A rs +RK +i eLe k+ +L++e +aL ++l +l+ + +l+++++ EPS63761.1 33 PKRAKRILANRKSAARSKERKMRYITELELKIGTLQGEASALCSQLAMLQRDSIQLTDQNK 93 59*************************************************9999999885 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.4E-12	30	94	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.036	32	95	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	7.3E-10	34	88	No hit	No description
SuperFamily	SSF57959	5.56E-11	34	90	No hit	No description
Pfam	PF00170	5.0E-9	34	93	IPR004827	Basic-leucine zipper domain
CDD	cd14703	2.12E-14	35	84	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
DAAVELSSNE FTEDEMKKIR GNKKLSEIAS ADPKRAKRIL ANRKSAARSK ERKMRYITEL 60 ELKIGTLQGE ASALCSQLAM LQRDSIQLTD QNKELKYRLQ ALEQQAQLED GM

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269\|PubMed:14704272}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007017723.1	2e-44	PREDICTED: uncharacterized protein LOC18591502
Refseq	XP_021283650.1	3e-44	uncharacterized protein LOC110416125
Refseq	XP_021283651.1	3e-44	uncharacterized protein LOC110416125
Refseq	XP_021283652.1	3e-44	uncharacterized protein LOC110416125
Swissprot	Q6S4P4	8e-34	RF2B_ORYSJ; Transcription factor RF2b
TrEMBL	S8CGP1	2e-73	S8CGP1_9LAMI; Uncharacterized protein (Fragment)
STRING	EOY14948	9e-44	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2507	23	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38900.3	6e-37	bZIP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Dai S,Zhang Z,Bick J,Beachy RN Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus. J. Gen. Virol., 2006. 87(Pt 3): p. 715-22 [PMID:16476995] Liu Y,Dai S,Beachy RN Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription. Biochem. J., 2007. 405(2): p. 243-9 [PMID:17371296] Dai S, et al. Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6 [PMID:19104064] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]