PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64141.1
Organism
Genlisea aurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family M-type_MADS
Protein Properties Length: 80aa    MW: 9033.71 Da    PI: 11.8316
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64141.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.84.5e-211360249
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                +ie k nrqvtf+kRr g++ KA+E+ vLC+ae a+++ s+ gk++ +
  EPS64141.1 13 KIEKKQNRQVTFTKRRMGLFRKASEIGVLCGAEMAILVRSPAGKIFAF 60
                69******************************************9987 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.45464IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-27463IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-25574IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-21626IPR002100Transcription factor, MADS-box
PfamPF003194.4E-221360IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-212641IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-214162IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
KKTLGRRKIE IRKIEKKQNR QVTFTKRRMG LFRKASEIGV LCGAEMAILV RSPAGKIFAF  60
GNPSPDSVIS LFLDDGRRSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A7e-17569165Myocyte-specific enhancer factor 2A
3mu6_B7e-17569165Myocyte-specific enhancer factor 2A
3mu6_C7e-17569165Myocyte-specific enhancer factor 2A
3mu6_D7e-17569165Myocyte-specific enhancer factor 2A
6byy_A1e-16469166MEF2 CHIMERA
6byy_B1e-16469166MEF2 CHIMERA
6byy_C1e-16469166MEF2 CHIMERA
6byy_D1e-16469166MEF2 CHIMERA
6bz1_A1e-16469166MEF2 CHIMERA
6bz1_B1e-16469166MEF2 CHIMERA
6bz1_C1e-16469166MEF2 CHIMERA
6bz1_D1e-16469166MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
UniProtProbable transcription factor that controls female gametophyte (megagametogenesis) development and chloroplast biogenesis during embryo development. {ECO:0000269|PubMed:18346189}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026456518.14e-26agamous-like MADS-box protein AGL29
SwissprotO808079e-24AGL23_ARATH; Agamous-like MADS-box protein AGL23
SwissprotQ9FKK21e-23AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLS8CHR39e-50S8CHR3_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.H00739.1.p1e-28(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-21AGAMOUS-like 62
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  3. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  4. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  5. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  6. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]