![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS64313.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 89aa MW: 10574.2 Da PI: 10.6852 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 123.4 | 1e-38 | 13 | 88 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
C v+gC+adl ++eyhrrh+vCe hskapvv++ ++e+rfCqqCsrfh+lsefD++krsCr+rL+ hn+rrrk q
EPS64313.1 13 CLVDGCAADLRLCREYHRRHRVCEPHSKAPVVTICNREHRFCQQCSRFHSLSEFDDGKRSCRKRLDWHNKRRRKMQ 88
**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 29.872 | 10 | 87 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 7.8E-31 | 10 | 74 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.11E-34 | 11 | 88 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.2E-29 | 13 | 86 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
SKRAKVVGGL VQCLVDGCAA DLRLCREYHR RHRVCEPHSK APVVTICNRE HRFCQQCSRF 60 HSLSEFDDGK RSCRKRLDWH NKRRRKMQP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 6e-27 | 9 | 86 | 7 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004239238.1 | 6e-40 | teosinte glume architecture 1 | ||||
| Refseq | XP_004239239.1 | 6e-40 | teosinte glume architecture 1 | ||||
| Refseq | XP_010321017.1 | 6e-40 | teosinte glume architecture 1 | ||||
| Refseq | XP_010321018.1 | 6e-40 | teosinte glume architecture 1 | ||||
| Refseq | XP_015074805.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_015074806.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_022885332.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_022885337.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_022885345.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_022885354.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_022885362.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_022885372.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_022885384.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_027772616.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_027772617.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Refseq | XP_027772619.1 | 6e-40 | teosinte glume architecture 1-like | ||||
| Swissprot | B9DI20 | 8e-35 | SP13A_ARATH; Squamosa promoter-binding-like protein 13A | ||||
| Swissprot | P0DI11 | 8e-35 | SP13B_ARATH; Squamosa promoter-binding-like protein 13B | ||||
| TrEMBL | S8DMT4 | 3e-58 | S8DMT4_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Solyc05g015840.2.1 | 2e-39 | (Solanum lycopersicum) | ||||
| STRING | PGSC0003DMT400056374 | 3e-39 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA4920 | 20 | 37 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G50670.1 | 3e-37 | SBP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




