PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS65348.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MYB_related

Protein Properties

Length: 101aa MW: 11400.1 Da PI: 12.1901

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS65348.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	39.4	1.4e-12	54	98	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 W++eE+ l++ + ++lG g+W+ I+r + + Rt q+ s+ qk+ EPS65348.1 54 TWSQEEHALFLMGLQRLGRGDWRGISRNFVTSRTSTQVASHAQKF 98 7******************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.122	47	101	IPR017930	Myb domain
SuperFamily	SSF46689	7.48E-15	50	101	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-8	51	101	IPR001005	SANT/Myb domain
TIGRFAMs	TIGR01557	4.1E-16	51	101	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	2.9E-10	52	94	IPR009057	Homeodomain-like
Pfam	PF00249	2.3E-9	54	97	IPR001005	SANT/Myb domain
CDD	cd00167	1.18E-7	54	99	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MRRKCSVCGN TGHNSRTCSV SGNIKTVKLL GVELAKSLPE QPTKNRRRGR KGVTWSQEEH 60 ALFLMGLQRL GRGDWRGISR NFVTSRTSTQ VASHAQKFFI R

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002989801.2	2e-30	transcription factor MYBS3
Refseq	XP_002990122.2	2e-30	transcription factor MYBS3 isoform X1
Refseq	XP_024519624.1	2e-30	transcription factor MYBS3 isoform X2
Swissprot	Q9LVS0	2e-27	KUA1_ARATH; Transcription factor KUA1
TrEMBL	S8DQP2	7e-68	S8DQP2_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_008775190.1	1e-29	(Phoenix dactylifera)
STRING	XP_010258761.1	1e-29	(Nelumbo nucifera)
STRING	EFJ08839	5e-31	(Selaginella moellendorffii)
STRING	EFJ09068	5e-31	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA7454	12	30

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47390.1	1e-29	MYB_related family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]