PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS65520.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

bZIP

Protein Properties

Length: 61aa MW: 7460.58 Da PI: 10.5259

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS65520.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	51.6	2e-16	11	58	3	50
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 + ++ r++kNRe+A rsR+RK+a+i eLe++v++L +eN++Lkk+l+ EPS65520.1 11 KNRKKLRLMKNRESAHRSRARKQAYIYELEQEVAQLMEENSKLKKQLK 58 567899**************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	1.4E-14	6	58	No hit	No description
SMART	SM00338	2.6E-4	6	60	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	3.0E-7	8	24	IPR001630	cAMP response element binding (CREB) protein
PROSITE profile	PS50217	10.978	11	61	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	6.2E-14	11	58	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.06E-11	13	59	No hit	No description
PROSITE pattern	PS00036	0	17	31	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	3.0E-7	26	46	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	3.0E-7	46	61	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
RIIDDDDDDA KNRKKLRLMK NRESAHRSRA RKQAYIYELE QEVAQLMEEN SKLKKQLKMK 60 R

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009802843.1	1e-14	PREDICTED: protein FD-like
Refseq	XP_016479923.1	1e-14	PREDICTED: protein FD-like
TrEMBL	S8CF75	1e-33	S8CF75_9LAMI; Uncharacterized protein (Fragment)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3572	22	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34000.3	4e-09	abscisic acid responsive elements-binding factor 3

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]