PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS66166.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

WRKY

Protein Properties

Length: 87aa MW: 10123.4 Da PI: 9.5142

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS66166.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	95.3	4.2e-30	14	72	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG K+vk+s +prsYY Ct++ C vkk+++r a+d+++v++tYeg Hnh+ EPS66166.1 14 LDDGYKWRKYGHKSVKNSSHPRSYYCCTHHACGVKKQIQRLANDKSIVVTTYEGIHNHP 72 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	5.1E-31	2	73	IPR003657	WRKY domain
SuperFamily	SSF118290	4.18E-27	6	73	IPR003657	WRKY domain
PROSITE profile	PS50811	26.808	9	74	IPR003657	WRKY domain
SMART	SM00774	2.9E-32	14	73	IPR003657	WRKY domain
Pfam	PF03106	8.0E-24	15	72	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
QRVAFHTRSE QDVLDDGYKW RKYGHKSVKN SSHPRSYYCC THHACGVKKQ IQRLANDKSI 60 VVTTYEGIHN HPSQNLLETL TPLLQFL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-25	4	71	7	74	Probable WRKY transcription factor 4
2lex_A	3e-25	4	71	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019160501.1	7e-47	PREDICTED: probable WRKY transcription factor 43
Swissprot	Q8VWQ4	3e-45	WRK56_ARATH; Probable WRKY transcription factor 56
TrEMBL	S8CMZ8	2e-59	S8CMZ8_9LAMI; Uncharacterized protein (Fragment)
STRING	Cagra.0062s0038.1.p	2e-44	(Capsella grandiflora)
STRING	XP_006301676.1	2e-44	(Capsella rubella)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA6374	24	33

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G64000.1	4e-41	WRKY DNA-binding protein 56

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]