PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS66216.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

HB-other

Protein Properties

Length: 106aa MW: 12641.4 Da PI: 8.359

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS66216.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	66.6	3.3e-21	2	57	1	56
TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +++ +++t++q++eLe++F+++++p++++r eL ++l L++rqVk+WFqNrR+++k EPS66216.1 2 KKRHHRHTPQQIQELEAVFKECPHPDEKQRSELISRLCLETRQVKFWFQNRRTQMK 57 566689***********************************************999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.8E-21	1	67	IPR009057	Homeodomain-like
SMART	SM00389	8.0E-16	1	63	IPR001356	Homeobox domain
PROSITE profile	PS50071	17.216	1	59	IPR001356	Homeobox domain
CDD	cd00086	1.50E-14	2	59	No hit	No description
Pfam	PF00046	1.0E-18	2	57	IPR001356	Homeobox domain
SuperFamily	SSF46689	2.65E-19	2	64	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
KKKRHHRHTP QQIQELEAVF KECPHPDEKQ RSELISRLCL ETRQVKFWFQ NRRTQMKTQL 60 ERHENSILRQ ENDELRAENI SIQDSMRNPI CTNCGGPAII GEIPLE

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269\|PubMed:10402424}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004144982.1	5e-62	PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
Refseq	XP_018832420.1	2e-62	PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like, partial
Refseq	XP_022958954.1	5e-62	homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
Swissprot	Q0WV12	5e-59	ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBL	S8CN57	5e-72	S8CN57_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_004144982.1	2e-61	(Cucumis sativus)
STRING	XP_004168157.1	2e-61	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA13886	8	14

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G00730.2	2e-62	HD-ZIP family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]