PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS66490.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

WRKY

Protein Properties

Length: 128aa MW: 14535.2 Da PI: 8.7879

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS66490.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.9	4.3e-33	67	125	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s+fprsYYrCt a+C vkk+vers +d++vv++tYeg+H+h+ EPS66490.1 67 LDDGYRWRKYGQKGVKNSPFPRSYYRCTAASCGVKKRVERSPRDKTVVITTYEGTHKHP 125 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	7.1E-34	52	127	IPR003657	WRKY domain
SuperFamily	SSF118290	1.23E-28	59	127	IPR003657	WRKY domain
PROSITE profile	PS50811	30.756	62	127	IPR003657	WRKY domain
SMART	SM00774	2.5E-34	67	126	IPR003657	WRKY domain
Pfam	PF03106	2.3E-26	68	125	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
DLLADDQQTH PTIPPPEYSD VVNSSGSDSN DEEDEIDGTL KKKEGKKVKG KKEPRFAFMT 60 KSDVDHLDDG YRWRKYGQKG VKNSPFPRSY YRCTAASCGV KKRVERSPRD KTVVITTYEG 120 THKHPCPM

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	9e-27	57	128	7	78	Probable WRKY transcription factor 4
2lex_A	9e-27	57	128	7	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006354313.1	7e-47	PREDICTED: probable WRKY transcription factor 48
Refseq	XP_010921433.1	6e-47	probable WRKY transcription factor 48
Refseq	XP_029120413.1	6e-47	probable WRKY transcription factor 48
Swissprot	Q8VWJ2	4e-42	WRK28_ARATH; WRKY transcription factor 28
TrEMBL	S8CIE5	4e-90	S8CIE5_9LAMI; Uncharacterized protein (Fragment)
STRING	PGSC0003DMT400029812	3e-46	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1309	24	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49520.1	2e-39	WRKY DNA-binding protein 48

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim SH, et al. Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis. Mol. Cells, 2014. 37(11): p. 833-40 [PMID:25358503] Zhao L, et al. KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535 [PMID:29288215]