PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS66506.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

S1Fa-like

Protein Properties

Length: 69aa MW: 7663.31 Da PI: 10.6884

Description

S1Fa-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS66506.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	S1FA	137.2	3.8e-43	5	69	6	70
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 e+kG nPGlivllv+gglll+flvgny+ly+yaqknlPP+kkkPvskkk+kre+lkqGv++PGe EPS66506.1 5 GEVKGYNPGLIVLLVIGGLLLLFLVGNYVLYIYAQKNLPPKKKKPVSKKKMKRERLKQGVSAPGE 69 599*************************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04689	2.6E-40	6	69	IPR006779	DNA binding protein S1FA

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 69 aa Download sequence Send to blast
LIENGEVKGY NPGLIVLLVI GGLLLLFLVG NYVLYIYAQK NLPPKKKKPV SKKKMKRERL 60 KQGVSAPGE

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010104121.2	1e-26	DNA-binding protein S1FA
Refseq	XP_024026346.1	1e-26	DNA-binding protein S1FA
Swissprot	Q42337	4e-15	S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBL	S8CNW9	2e-38	S8CNW9_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_010104121.1	4e-26	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3174	22	49

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]