PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS67777.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

GRF

Protein Properties

Length: 114aa MW: 12927.6 Da PI: 10.9383

Description

GRF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS67777.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	80.5	1.6e-25	59	103	1	45
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 daepgrCrRtDGKkWRCsr++++++k+CErH++rgr rsrk++e EPS67777.1 59 DAEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRPRSRKPVEG 103 79****************************************986 PP
2	QLQ	49.1	1.7e-17	1	36	2	37
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 +FT++Q+++L++ +l+ +y+aan+PvPp+Ll+++++ EPS67777.1 1 PFTPSQWMELEHHALIHRYIAANVPVPPNLLLPLKR 36 8********************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51666	21.191	1	36	IPR014978	Glutamine-Leucine-Glutamine, QLQ
SMART	SM00951	3.3E-6	1	36	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	8.4E-12	1	34	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	25.01	59	103	IPR014977	WRC domain
Pfam	PF08879	5.9E-22	60	102	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 114 aa Download sequence Send to blast
PFTPSQWMEL EHHALIHRYI AANVPVPPNL LLPLKRSHTS DLRMSALRWG SFPLGFSGDA 60 EPGRCRRTDG KKWRCSRDAV PDQKYCERHI NRGRPRSRKP VEGQNGHASS SSSS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
UniProt	Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015890408.1	8e-52	growth-regulating factor 1 isoform X1
Swissprot	Q6AWY2	1e-47	GRF7_ORYSJ; Growth-regulating factor 7
Swissprot	Q6AWY3	1e-47	GRF6_ORYSJ; Growth-regulating factor 6
TrEMBL	S8E5W6	5e-79	S8E5W6_9LAMI; Uncharacterized protein (Fragment)
STRING	EMJ09229	4e-50	(Prunus persica)
STRING	XP_010273541.1	3e-50	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1688	23	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22840.1	1e-40	growth-regulating factor 1

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Liu H, et al. OsmiR396d-regulated OsGRFs function in floral organogenesis in rice through binding to their targets OsJMJ706 and OsCR4. Plant Physiol., 2014. 165(1): p. 160-74 [PMID:24596329] Gao F, et al. Blocking miR396 increases rice yield by shaping inflorescence architecture. Nat Plants, 2015. 2: p. 15196 [PMID:27250748]