PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS68084.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

G2-like

Protein Properties

Length: 215aa MW: 24091.8 Da PI: 10.615

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS68084.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	87.5	1.3e-27	35	87	2	55
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +++WtpeLH+rFv+aveqL G ekA+P++ilelm++++Lt+++++SHLQkYR+ EPS68084.1 35 LKVDWTPELHRRFVQAVEQL-GLEKAVPSRILELMGIDCLTRHNIASHLQKYRS 87 5899**************.******************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.583	31	90	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.4E-26	32	91	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.57E-18	33	90	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.6E-26	34	88	IPR006447	Myb domain, plants
Pfam	PF00249	2.9E-8	37	86	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009658	Biological Process	chloroplast organization
GO:0009910	Biological Process	negative regulation of flower development
GO:0010380	Biological Process	regulation of chlorophyll biosynthetic process
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:1900056	Biological Process	negative regulation of leaf senescence
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 215 aa Download sequence Send to blast
MEDAAAVDPS PEDSARSGKS PSARSKNHQE KRKKLKVDWT PELHRRFVQA VEQLGLEKAV 60 PSRILELMGI DCLTRHNIAS HLQKYRSQRR RSLAREAETK QRCQIYGGGA PAMGFPPYNF 120 RPYYSFPTEQ APGMAVAPTA PLQRLDRGLV ATSCAVPPSK ENVDIAIEDV LAKPWLPLPL 180 GLKPPSVDSV LIELQRQGIS KIPPTKCKNR RRRRL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	2e-16	32	86	3	57	ARR10-B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that functions with GLK1 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269\|PubMed:11828027, ECO:0000269\|PubMed:12220263, ECO:0000269\|PubMed:18643989, ECO:0000269\|PubMed:19376934, ECO:0000269\|PubMed:19383092, ECO:0000269\|PubMed:19726569, ECO:0000269\|PubMed:23459204}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By light. Repressed by BZR2. {ECO:0000269\|PubMed:12220263, ECO:0000269\|PubMed:21214652}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017433609.1	3e-63	PREDICTED: transcription activator GLK1-like isoform X2
Swissprot	Q9FFH0	7e-37	GLK2_ARATH; Transcription activator GLK2
TrEMBL	S8CLP5	1e-156	S8CLP5_9LAMI; Golden 2-like protein 2
STRING	XP_004487197.1	4e-57	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2532	23	56

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G44190.1	1e-39	GOLDEN2-like 2

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Leister D,Kleine T Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants. Physiol Plant, 2016. 157(3): p. 297-309 [PMID:26876646] Nagatoshi Y, et al. GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23 [PMID:27035938] Han XY, et al. GOLDEN2-LIKE transcription factors coordinate the tolerance to Cucumber mosaic virus in Arabidopsis. Biochem. Biophys. Res. Commun., 2016. 477(4): p. 626-632 [PMID:27346129] Ni F, et al. Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis. Mol Plant, 2017. 10(5): p. 764-766 [PMID:27964999] Bastakis E,Hedtke B,Klermund C,Grimm B,Schwechheimer C LLM-Domain B-GATA Transcription Factors Play Multifaceted Roles in Controlling Greening in Arabidopsis. Plant Cell, 2018. 30(3): p. 582-599 [PMID:29453227] Zubo YO, et al. Coordination of Chloroplast Development through the Action of the GNC and GLK Transcription Factor Families. Plant Physiol., 2018. 178(1): p. 130-147 [PMID:30002259]