PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS68360.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

Dof

Protein Properties

Length: 82aa MW: 9678.23 Da PI: 10.398

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS68360.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	121.3	3.5e-38	25	82	2	59
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 +e++l+cprC s++tkfCyynny+++qPryfCk C+ryWt+GG++rnvPvG+g+rk+k EPS68360.1 25 PERILPCPRCSSRDTKFCYYNNYNVNQPRYFCKVCQRYWTEGGTMRNVPVGAGKRKSK 82 67899***************************************************87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF02701	3.7E-32	28	82	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	5.0E-24	28	82	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.164	29	82	IPR003851	Zinc finger, Dof-type
Gene3D	G3DSA:2.20.25.10	8.7E-4	29	67	No hit	No description
PROSITE pattern	PS01361	0	31	67	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 82 aa Download sequence Send to blast
EDSAITETTE VKKKKKPERK LLKKPERILP CPRCSSRDTK FCYYNNYNVN QPRYFCKVCQ 60 RYWTEGGTMR NVPVGAGKRK SK

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	11	23	KKKKKPERKLLKK
2	14	23	KKPERKLLKK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021614753.1	3e-36	cyclic dof factor 3-like
Swissprot	Q8LFV3	2e-35	CDF3_ARATH; Cyclic dof factor 3
TrEMBL	S8CNU1	3e-53	S8CNU1_9LAMI; Uncharacterized protein (Fragment)
STRING	cassava4.1_007172m	1e-35	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA88	24	419

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G47500.1	3e-32	cycling DOF factor 3

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Corrales AR, et al. Multifaceted role of cycling DOF factor 3 (CDF3) in the regulation of flowering time and abiotic stress responses in Arabidopsis. Plant Cell Environ., 2017. 40(5): p. 748-764 [PMID:28044345] Renau-Morata B, et al. Ectopic Expression of CDF3 Genes in Tomato Enhances Biomass Production and Yield under Salinity Stress Conditions. Front Plant Sci, 2017. 8: p. 660 [PMID:28515731] Henriques R, et al. The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering. New Phytol., 2017. 216(3): p. 854-867 [PMID:28758689]