![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS68410.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 151aa MW: 17034.5 Da PI: 10.7426 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 54.6 | 1.4e-17 | 86 | 120 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C +C + kTp+WR+gp g+ktLCnaCG++y++ +l
EPS68410.1 86 CWHCESDKTPQWREGPMGPKTLCNACGVRYKSGRL 120
99*****************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 5.4E-15 | 80 | 130 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 8.55E-15 | 83 | 143 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 9.9E-15 | 84 | 118 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE profile | PS50114 | 10.726 | 84 | 116 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 1.10E-11 | 85 | 132 | No hit | No description |
| Pfam | PF00320 | 1.3E-15 | 86 | 120 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 86 | 111 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007623 | Biological Process | circadian rhythm | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 151 aa Download sequence Send to blast |
EEELEWLSNR DAFPPLESCF GILSDNPNLI PNQTSPVSVL RSAKPPPSKP RTLRSRKRRT 60 TFTTPVVKEA SSSAAAASEV GMRKRCWHCE SDKTPQWREG PMGPKTLCNA CGVRYKSGRL 120 LPEYRPANSP TFCSLLHSNS HRKVVQMRKR K |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 54 | 59 | SRKRRT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00377 | DAP | Transfer from AT3G24050 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011073745.1 | 7e-55 | GATA transcription factor 1-like | ||||
| Swissprot | Q6DBP8 | 1e-35 | GAT11_ARATH; GATA transcription factor 11 | ||||
| Swissprot | Q8LAU9 | 9e-36 | GATA1_ARATH; GATA transcription factor 1 | ||||
| TrEMBL | S8CNX3 | 1e-106 | S8CNX3_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Migut.G00615.1.p | 3e-53 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA4076 | 24 | 45 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24050.1 | 1e-36 | GATA transcription factor 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




