PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS68652.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

WRKY

Protein Properties

Length: 91aa MW: 10717.2 Da PI: 10.4519

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS68652.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	107.9	4.8e-34	21	79	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s+fprsYYrCts+ C vkk+vers ed ++v++tYeg+H+h+ EPS68652.1 21 LDDGYRWRKYGQKGVKNSPFPRSYYRCTSTPCGVKKRVERSPEDRSIVITTYEGTHTHP 79 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	5.6E-35	7	81	IPR003657	WRKY domain
SuperFamily	SSF118290	3.01E-30	13	81	IPR003657	WRKY domain
PROSITE profile	PS50811	30.595	16	81	IPR003657	WRKY domain
SMART	SM00774	8.4E-37	21	80	IPR003657	WRKY domain
Pfam	PF03106	1.3E-27	22	79	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
KKNGEMEPRF SFMTKSEIDQ LDDGYRWRKY GQKGVKNSPF PRSYYRCTST PCGVKKRVER 60 SPEDRSIVIT TYEGTHTHPR PLPRGTFRML T

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-27	12	81	8	77	Probable WRKY transcription factor 4
2lex_A	1e-27	12	81	8	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011100744.2	2e-44	probable WRKY transcription factor 48, partial
Refseq	XP_012846599.1	3e-45	PREDICTED: probable WRKY transcription factor 48, partial
Swissprot	Q9FGZ4	9e-41	WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBL	S8E871	3e-61	S8E871_9LAMI; Uncharacterized protein (Fragment)
STRING	Solyc05g053380.2.1	7e-43	(Solanum lycopersicum)
STRING	Migut.N00035.1.p	2e-42	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1309	24	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49520.1	4e-43	WRKY DNA-binding protein 48

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]