PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS69527.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

SBP

Protein Properties

Length: 83aa MW: 9768.03 Da PI: 8.8809

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS69527.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	131.8	2.4e-41	2	78	1	77
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cqv++C++dls k+yh+rh+vCe+hska+++lv ++ qrfCqqCsrfh l+efDe+krsCrrrL++hn+rrrk + EPS69527.1 2 ACQVDDCTEDLSVGKDYHKRHRVCEIHSKASEALVGKQPQRFCQQCSRFHPLEEFDEGKRSCRRRLDGHNRRRRKGH 78 5*************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51141	30.496	1	77	IPR004333	Transcription factor, SBP-box
Gene3D	G3DSA:4.10.1100.10	7.7E-32	2	64	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.49E-37	2	81	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.2E-31	3	76	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
LACQVDDCTE DLSVGKDYHK RHRVCEIHSK ASEALVGKQP QRFCQQCSRF HPLEEFDEGK 60 RSCRRRLDGH NRRRRKGHPE VIP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	3e-31	3	76	11	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022878999.1	3e-41	squamosa promoter-binding-like protein 14
Refseq	XP_022879000.1	3e-41	squamosa promoter-binding-like protein 14
Swissprot	Q700C2	4e-42	SPL16_ARATH; Squamosa promoter-binding-like protein 16
TrEMBL	S8EAH5	1e-53	S8EAH5_9LAMI; Uncharacterized protein (Fragment)
STRING	AT1G76580.1	2e-40	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA749	24	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G76580.1	1e-34	SBP family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]