![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS70299.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 177aa MW: 20335.4 Da PI: 9.8533 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 108.4 | 3.7e-34 | 41 | 95 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
k+r+rWt+eLHe+Fveav++LGGsekAtPk il+lmkv++Lt++hvkSHLQkYR+
EPS70299.1 41 KQRMRWTQELHESFVEAVNKLGGSEKATPKGILKLMKVDSLTIYHVKSHLQKYRT 95
79****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.17 | 38 | 98 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.52E-19 | 39 | 95 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-31 | 40 | 97 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.3E-26 | 41 | 95 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 3.9E-10 | 43 | 94 | IPR001005 | SANT/Myb domain |
| Pfam | PF14379 | 1.9E-25 | 128 | 173 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007623 | Biological Process | circadian rhythm | ||||
| GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
| GO:0055063 | Biological Process | sulfate ion homeostasis | ||||
| GO:0071486 | Biological Process | cellular response to high light intensity | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 177 aa Download sequence Send to blast |
FQMRKEPINI SVQQSLIPKQ PPGEVFSGIG QSSSMNIAPA KQRMRWTQEL HESFVEAVNK 60 LGGSEKATPK GILKLMKVDS LTIYHVKSHL QKYRTARYKP ETNVEDSSEK KSSTMPELSS 120 LDLKAGIDIS EALRLQIEVQ KRLHEQLEIQ RNLQLRIEEQ GRYLQMMFER QCKPGID |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 2e-31 | 40 | 99 | 1 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 2e-31 | 40 | 99 | 1 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 2e-31 | 40 | 99 | 1 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 2e-31 | 40 | 99 | 1 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 2e-31 | 40 | 99 | 1 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 2e-31 | 40 | 99 | 1 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 2e-31 | 40 | 99 | 1 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 2e-31 | 40 | 99 | 1 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}. | |||||
| UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022890592.1 | 7e-92 | protein PHOSPHATE STARVATION RESPONSE 1-like | ||||
| Swissprot | B8ANX9 | 3e-68 | PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1 | ||||
| Swissprot | Q10LZ1 | 3e-68 | PHR1_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 1 | ||||
| TrEMBL | S8CSL4 | 1e-127 | S8CSL4_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Migut.D00466.1.p | 1e-85 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2753 | 23 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28610.1 | 1e-69 | phosphate starvation response 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




