PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS71505.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MYB_related

Protein Properties

Length: 126aa MW: 14490.4 Da PI: 10.8924

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS71505.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	40.6	5.7e-13	17	61	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT++E++++ +a +++ + Wk+I + +g + q++s+ qky EPS71505.1 17 RESWTEQEHDKFFEALHLFDRD-WKKIEAFVG-SKNVIQIRSHAQKY 61 789***************77.*****.***********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	7.48E-16	11	67	IPR009057	Homeodomain-like
PROSITE profile	PS51294	13.883	12	66	IPR017930	Myb domain
TIGRFAMs	TIGR01557	1.9E-16	15	64	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	5.7E-6	15	67	IPR009057	Homeodomain-like
SMART	SM00717	6.8E-10	16	64	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-10	17	61	IPR001005	SANT/Myb domain
CDD	cd00167	7.02E-8	19	62	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
DDSKVKVRKP YTITKSRESW TEQEHDKFFE ALHLFDRDWK KIEAFVGSKN VIQIRSHAQK 60 YFLKVTKNGA SERVPPPRPK RKASHPYPQK ARKNASLDST RHLDAYSIPR NSGSTVTRSG 120 PSPITT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:21474993, ECO:0000269\|PubMed:21483796, ECO:0000269\|PubMed:23638299}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:22902701, ECO:0000269\|PubMed:23638299}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003570106.1	2e-57	protein REVEILLE 6 isoform X1
Refseq	XP_010235824.1	2e-57	protein REVEILLE 6 isoform X2
Swissprot	Q8RWU3	7e-52	RVE8_ARATH; Protein REVEILLE 8
TrEMBL	S8CX69	2e-87	S8CX69_9LAMI; Uncharacterized protein (Fragment)
STRING	BRADI3G51757.2	8e-57	(Brachypodium distachyon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA998	24	78

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G09600.2	2e-54	MYB_related family protein

Publications ? help Back to Top
Manfield IW, et al. Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis. Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9 [PMID:16845059] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Fogelmark K,Troein C Rethinking transcriptional activation in the Arabidopsis circadian clock. PLoS Comput. Biol., 2014. 10(7): p. e1003705 [PMID:25033214] Xing H, et al. LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors. Plant Signal Behav, 2015. 10(3): p. e1010888 [PMID:25848708] Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size. Plant Physiol., 2017. 173(4): p. 2308-2322 [PMID:28254761]